PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000318376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 323aa    MW: 36537.8 Da    PI: 7.4768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000318376genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+lv++++ +G+g+W+++++  g+ R++k+c++rw++yl
    MDP0000318376 14 RGLWSPEEDEKLVRYITTYGPGCWRKVPEQAGLQRCGKSCRLRWLNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding45.51.8e-1467111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eE++l+v++    G++ W+ Ia++++ gRt++++k++w+++
    MDP0000318376  67 RGGFTPEEEKLIVRLNGVVGNR-WAHIAKCLP-GRTDNEIKNYWNSW 111
                      788*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-26664IPR009057Homeodomain-like
PROSITE profilePS5129424.976965IPR017930Myb domain
SuperFamilySSF466894.49E-2912108IPR009057Homeodomain-like
SMARTSM007176.0E-141363IPR001005SANT/Myb domain
PfamPF002492.2E-161461IPR001005SANT/Myb domain
CDDcd001671.20E-111761No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129416.86266116IPR017930Myb domain
SMARTSM007179.5E-1566114IPR001005SANT/Myb domain
PfamPF002497.3E-1367111IPR001005SANT/Myb domain
CDDcd001673.52E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGHHYCCKQR KVKRGLWSPE EDEKLVRYIT TYGPGCWRKV PEQAGLQRCG KSCRLRWLNY  60
LRPDIKRGGF TPEEEKLIVR LNGVVGNRWA HIAKCLPGRT DNEIKNYWNS WIKKKLEKPS  120
SPPITSPSNI DHQHNNQMGC SYPNQQEFLS HNFITKPTAP REILYPSPYP LFMFGADEIT  180
IKNINVQSAD QDFPLAVSNN SNNNGTWILD QQQHHQVQAX PPSTAEFTNN NMDAQFLPSL  240
LGSNIGNNNM VPLVVESCGN IDEGGEISME CLQNTTQELN ALVHSRQAQQ CSSNSFHFWD  300
IVEGPSSSNL GSANILSSFP SYQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392482.10.0PREDICTED: myb-related protein 315
TrEMBLM5WCE01e-175M5WCE0_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s13190.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.14e-72myb domain protein 103